PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G216400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 324aa    MW: 36526.2 Da    PI: 5.4884
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G216400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB69.46.4e-221193385
               NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
                        ++d  lP + + +i+k++lP + ++++d+++++ ec +efi +++se++d c re++kti+++ ++ al +lGf++y+e++ +
  Brast03G216400.1.p 11 KEDVSLPKSTMFKIIKEMLPPDVRVARDTQDLLVECCVEFINLLSSESNDVCSREEKKTIAPEHVIRALQDLGFKEYIEEVYA 93
                        67999**************************************************************************9854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.4E-378140IPR009072Histone-fold
SuperFamilySSF471133.64E-3312140IPR009072Histone-fold
PfamPF008081.2E-171579IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MDPMDIVGKS KEDVSLPKST MFKIIKEMLP PDVRVARDTQ DLLVECCVEF INLLSSESND  60
VCSREEKKTI APEHVIRALQ DLGFKEYIEE VYAAYEQHKL DTMDSPKASK FTGVEMSEEE  120
AVAEQQRMFA EARARMNNGA AKPKESELEP QKQPQLQLHP PAHQPSQVYG QPQQPLHAQV  180
QLHPQPQQPL HAQVQLHPQA QPQQPLHAQV QLHPQPQQPP QPQLQLQPQA QPPQTLQPQP  240
QLQLQPQAQP QQTLQPQLQF HPQPQHTILP LLQPQPQQPP PQPELQLHPQ SEQPTQAQLQ  300
PQAQEPQPQL QAQSQTEHGL GSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B3e-321213312133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4649031e-172AF464903.1 Triticum aestivum repressor protein (Dr1) mRNA, complete cds.
GenBankBT0092341e-172BT009234.1 Triticum aestivum clone wle1n.pk0106.g11:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235094.11e-164PREDICTED: nuclear transcription factor Y subunit beta-like
TrEMBLI1I6Q31e-164I1I6Q3_BRADI; Uncharacterized protein
STRINGBRADI3G34930.11e-164(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57203549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.43e-79nuclear factor Y, subunit B13